PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr022067.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family LBD
Protein Properties Length: 233aa    MW: 25153.5 Da    PI: 6.9798
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr022067.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.25.1e-42771761100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++Cvlapyfp ++p kf ++hk+FGasn++kll+++pe++r da+ss+vyeA+ar++dPvyG++g i++lq+q+ +l+a+la+++
  Pbr022067.1  77 PCAACKILRRRCAEKCVLAPYFPPTEPLKFTIAHKVFGASNIIKLLQEIPESHRADAVSSMVYEANARIHDPVYGCAGAIFQLQKQVGELQAQLAKTQ 174
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  Pbr022067.1 175 AE 176
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.6976177IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-4177174IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MEFNAKTTTT TTSTASLPPP FSYSPSSTSS PSTSSFPSPN SQHLSNYPSP HASNSNIATN  60
PSPTSPSPPP PTVILSPCAA CKILRRRCAE KCVLAPYFPP TEPLKFTIAH KVFGASNIIK  120
LLQEIPESHR ADAVSSMVYE ANARIHDPVY GCAGAIFQLQ KQVGELQAQL AKTQAELVNM  180
QCQQGNLIAL ICMDMTKSKE QAILQQQQSN NIDTSCFLDE NNLGTAWEPL WT*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009378148.11e-171PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR02e-73LBD1_ARATH; LOB domain-containing protein 1
TrEMBLM5X5X51e-105M5X5X5_PRUPE; Uncharacterized protein
STRINGPOPTR_0008s04350.12e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.19e-74LOB domain-containing protein 1